Structure of PDB 2rmc Chain A Binding Site BS01

Receptor Information
>2rmc Chain A (length=182) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRGPSVTDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGY
GYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIG
WVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQA
TDGHDRPLTDCTIVNSGKIDVKTPFVVEVPDW
Ligand information
>2rmc Chain B (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTPGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rmc Crystal Structure of Murine Cyclophilin C Complexed with Immunosuppressive Drug Cyclosporin A
Resolution1.64 Å
Binding residue
(original residue number in PDB)		R89 F94 Q97 G106 A135 N136 A137 Q145 F147 W155 H160
Binding residue
(residue number reindexed from 1)		R59 F64 Q67 G76 A105 N106 A107 Q115 F117 W125 H130
Enzymatic activity
Catalytic site (original residue number in PDB) R89 F94 Q97 N136 F147 L156 H160
Catalytic site (residue number reindexed from 1) R59 F64 Q67 N106 F117 L126 H130
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2rmc, PDBe:2rmc, PDBj:2rmc
PDBsum2rmc
PubMed8265636
UniProtP30412|PPIC_MOUSE Peptidyl-prolyl cis-trans isomerase C (Gene Name=Ppic)

[Back to BioLiP]