Structure of PDB 2rky Chain A Binding Site BS01

Receptor Information
>2rky Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCN
DQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCER
Ligand information
>2rky Chain D (length=19) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KNGPIIQNNKFEYKEDTIK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rky Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains
Resolution1.8 Å
Binding residue
(original residue number in PDB)
F156 H158 Y174 M178 V180 S189 G190 R191 I192 T193 C194 T195 S196 K217 L225 R234 G235 E236 W237 K238 C239 R241
Binding residue
(residue number reindexed from 1)
F5 H7 Y23 M27 V29 S38 G39 R40 I41 T42 C43 T44 S45 K66 L74 R83 G84 E85 W86 K87 C88 R90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:2rky, PDBe:2rky, PDBj:2rky
PDBsum2rky
PubMed18713862
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]