Structure of PDB 2rfe Chain A Binding Site BS01

Receptor Information

>2rfe Chain A (length=286) Species: 9606 (Homo sapiens)

MALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREA
TSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLD
YVREHKDNIGSQYLLNWCVQIAEGMNYLEDRRLVHRDLAARNVLVKTPQH
VKITDFGLAKLLGAEEKVPIKWMALESILHRIYTHQSDVWSYGVTVWELM
TFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELIIEFSKMARDPQRYLVIQGPTDSNFYRALM

Ligand information

>2rfe Chain E (length=26) Species: 9606 (Homo sapiens)

SLPSYLNGVMPPTQSFAPDPKYVSSK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2rfe Inhibition of the EGF receptor by binding of MIG6 to an activating kinase domain interface.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): W881 E904 G906 E907 R908 P910 Q911 P913 C915 T916 I917 Y920 V924 M928 I929
• Binding residue (residue number reindexed from 1): W197 E220 G222 E223 R224 P226 Q227 P229 C231 T232 I233 Y236 V240 M244 I245

Enzymatic activity

• Catalytic site (original residue number in PDB): D813 A815 R817 N818 D831
• Catalytic site (residue number reindexed from 1): D137 A139 R141 N142 D155
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:2rfe, PDBe:2rfe, PDBj:2rfe
• PDBsum: 2rfe
• PubMed: 18046415
• UniProt: P00533|EGFR_HUMAN Epidermal growth factor receptor (Gene Name=EGFR)