Structure of PDB 2rf9 Chain A Binding Site BS01

Receptor Information

>2rf9 Chain A (length=280) Species: 9606 (Homo sapiens)

PNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELR
EPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDY
VREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHV
KITDFGLAKLLGAEEKEYHAGKVPIKWMALESILHRIYTHQSDVWSYGVT
VWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQG

Ligand information

>2rf9 Chain C (length=27) Species: 9606 (Homo sapiens)

KSLPSYLNGVMPPTQSFAPDPKYVSSK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2rf9 Inhibition of the EGF receptor by binding of MIG6 to an activating kinase domain interface.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): W881 E904 G906 E907 R908 P910 Q911 P913 C915 T916 I917 Y920 V924 M928 I929 V956
• Binding residue (residue number reindexed from 1): W202 E225 G227 E228 R229 P231 Q232 P234 C236 T237 I238 Y241 V245 M249 I250 V277

Enzymatic activity

• Catalytic site (original residue number in PDB): D813 A815 R817 N818 D831 G850
• Catalytic site (residue number reindexed from 1): D136 A138 R140 N141 D154 G171
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:2rf9, PDBe:2rf9, PDBj:2rf9
• PDBsum: 2rf9
• PubMed: 18046415
• UniProt: P00533|EGFR_HUMAN Epidermal growth factor receptor (Gene Name=EGFR)