Structure of PDB 2rdl Chain A Binding Site BS01

Receptor Information
>2rdl Chain A (length=226) Species: 10036 (Mesocricetus auratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGTECRPHARPYMAYLEIVTPENHLSACSGFLIRRNFVMTAAHCAGRS
ITVLLGAHNKKVKEDTWQKLEVEKQFPHPKYDDRLVLNDIMLLKLKEKAN
LTLGVGTLPISAKSNSIPPGRVCRAVGWGRTNVNEPPSDTLQEVKMRILD
PQACKHFEDFHQEPQLCVGNPKKIRNVYKGDSGGPLLCAGIAQGIASYVL
RNAKPPSVFTRISHYRPWINKILREN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rdl Structural basis for elastolytic substrate specificity in rodent alpha-chymases.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H57 Y191 S195 S214 Y215 V216 R218 N219
Binding residue
(residue number reindexed from 1)		H45 Y178 S182 S197 Y198 V199 R201 N202
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 G193 S195 G196
Catalytic site (residue number reindexed from 1) H45 D89 G180 S182 G183
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2rdl, PDBe:2rdl, PDBj:2rdl
PDBsum2rdl
PubMed17981788
UniProtO70164

[Back to BioLiP]