Structure of PDB 2rba Chain A Binding Site BS01

Receptor Information
>2rba Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQ
LNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKY
QPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSS
SARCAQFPRAQDKVHYYIKLKDLRDQLKGIER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rba Crystal structure of human thymine DNA glycosylase bound to DNA elucidates sequence-specific mismatch recognition.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		P155 K246 K248 A274 A277 P280
Binding residue
(residue number reindexed from 1)		P33 K124 K126 A152 A155 P158
Enzymatic activity
Catalytic site (original residue number in PDB) H151
Catalytic site (residue number reindexed from 1) H29
Enzyme Commision number 3.2.2.29: thymine-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0000700 mismatch base pair DNA N-glycosylase activity
Biological Process
GO:0006285 base-excision repair, AP site formation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2rba, PDBe:2rba, PDBj:2rba
PDBsum2rba
PubMed18587051
UniProtQ13569|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase (Gene Name=TDG)

[Back to BioLiP]