Structure of PDB 2r5y Chain A Binding Site BS01

Receptor Information
>2r5y Chain A (length=73) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKKNPPQIYPWMKRVQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL
SLTERQIKIWFQNRRMKWKKEHK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2r5y Functional specificity of a Hox protein mediated by the recognition of minor groove structure
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R105 T106 Y108 R143 Q144 I147 N151
Binding residue
(residue number reindexed from 1)		R17 T18 Y20 R55 Q56 I59 N63
Binding affinityPDBbind-CN: Kd=10.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2r5y, PDBe:2r5y, PDBj:2r5y
PDBsum2r5y
PubMed17981120
UniProtP09077|SCR_DROME Homeotic protein Sex combs reduced (Gene Name=Scr)

[Back to BioLiP]