Structure of PDB 2r5m Chain A Binding Site BS01

Receptor Information

>2r5m Chain A (length=212) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AFDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTC
IATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPP
LGFCMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAV
DKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCA
RSCHPMQPPGHK

Ligand information

>2r5m Chain L (length=3) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RKS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2r5m Structural and functional analyses of methyl-lysine binding by the malignant brain tumour repeat protein Sex comb on midleg.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	D324 N327 W351
Binding residue (residue number reindexed from 1)	D151 N154 W178

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2r5m, PDBe:2r5m, PDBj:2r5m
PDBsum	2r5m
PubMed	17932512
UniProt	Q9VHA0\|SCM_DROME Polycomb protein Scm (Gene Name=Scm)

[Back to BioLiP]