Structure of PDB 2r5b Chain A Binding Site BS01

Receptor Information
>2r5b Chain A (length=45) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Ligand information
>2r5b Chain H (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGACDYPEWQWLCAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2r5b Potent D-peptide inhibitors of HIV-1 entry
Resolution2.0 Å
Binding residue
(original residue number in PDB)
L32 W35 L40
Binding residue
(residue number reindexed from 1)
L32 W35 L40
External links