Structure of PDB 2r0l Chain A Binding Site BS01

Receptor Information
>2r0l Chain A (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDS
VSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKG
DRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREA
LVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKN
GVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2r0l Structural insight into distinct mechanisms of protease inhibition by antibodies.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		S26 W29 R114 Q116 P120 C122 V206 A207
Binding residue
(residue number reindexed from 1)		S11 W14 R106 Q108 P112 C114 V202 A203
Enzymatic activity
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2r0l, PDBe:2r0l, PDBj:2r0l
PDBsum2r0l
PubMed18077410
UniProtQ04756|HGFA_HUMAN Hepatocyte growth factor activator (Gene Name=HGFAC)

[Back to BioLiP]