Structure of PDB 2qzx Chain A Binding Site BS01

Receptor Information

>2qzx Chain A (length=342) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPVAVTLHNEAITYTADITVGSDNQKLNVIVDTGSSDLWIPDSNVICIPK
WRGDKGDFCKSAGSYSPASSRTSQNLNTRFDIKYGDGSYAKGKLYKDTVG
IGGVSVRDQLFANVWSTSARKGILGIGFQSGEATEFDYDNLPISLRNQGI
IGKAAYSLYLNSAEASTGQIIFGGIDKAKYSGSLVDLPITSEKKLTVGLR
SVNVRGRNVDANTNVLLDSGTTISYFTRSIVRNILYAIGAQMKFDSAGNK
VYVADCKTSGTIDFQFGNNLKISVPVSEFLFQTYYTSGKPFPKCEVRIRE
SEDNILGDNFLRSAYVVYNLDDKKISMAPVKYTSESDIVAIN

Ligand information

>2qzx Chain C (length=6) Species: 285516 (Streptomyces argenteolus subsp. toyonakensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VVVLAL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2qzx X-ray structures of Sap1 and Sap5: Structural comparison of the secreted aspartic proteinases from Candida albicans.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	D32 G34 K83 Y84 G85 D86 I123 D218 G220 T221 T222 Y225
Binding residue (residue number reindexed from 1)	D32 G34 K83 Y84 G85 D86 I123 D218 G220 T221 T222 Y225

Enzymatic activity

Catalytic site (original residue number in PDB)	D32 S35 D37 W39 Y84 D218 T221
Catalytic site (residue number reindexed from 1)	D32 S35 D37 W39 Y84 D218 T221
Enzyme Commision number	3.4.23.24: candidapepsin.

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2qzx, PDBe:2qzx, PDBj:2qzx
PDBsum	2qzx
PubMed	18384081
UniProt	P43094\|CARP5_CANAL Secreted aspartic protease 5 (Gene Name=SAP5)

[Back to BioLiP]