Structure of PDB 2qyf Chain A Binding Site BS01

Receptor Information
>2qyf Chain A (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QGITARGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTD
LELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDK
TAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTD
KDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qyf p31comet blocks Mad2 activation through structural mimicry.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		I37 Y38 E60 Y64 V85 F151 D152 L153 L154 I155 Y156 T157 D160 W167 E168 E169 S170 P172
Binding residue
(residue number reindexed from 1)		I29 Y30 E52 Y56 V77 F143 D144 L145 L146 I147 Y148 T149 D152 W159 E160 E161 S162 P164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0000132 establishment of mitotic spindle orientation
GO:0007094 mitotic spindle assembly checkpoint signaling
GO:0042177 negative regulation of protein catabolic process
GO:0043066 negative regulation of apoptotic process
GO:0045930 negative regulation of mitotic cell cycle
GO:0051301 cell division
GO:0051660 establishment of centrosome localization
GO:0090267 positive regulation of mitotic cell cycle spindle assembly checkpoint
GO:1904667 negative regulation of ubiquitin protein ligase activity
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0033597 mitotic checkpoint complex
GO:0044615 nuclear pore nuclear basket
GO:0048471 perinuclear region of cytoplasm
GO:0072686 mitotic spindle
GO:1990728 mitotic spindle assembly checkpoint MAD1-MAD2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2qyf, PDBe:2qyf, PDBj:2qyf
PDBsum2qyf
PubMed18022368
UniProtQ13257|MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A (Gene Name=MAD2L1)

[Back to BioLiP]