Structure of PDB 2qv1 Chain A Binding Site BS01

Receptor Information
>2qv1 Chain A (length=151) Species: 3052230 (Hepacivirus hominis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEGEVQIMSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNV
DQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLS
PRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETT
M
Ligand information
>2qv1 Chain C (length=16) Species: 63746 (Hepatitis C virus (isolate H77)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSVVIVGRIVLSGKPA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qv1 Phenotypic and Structural Analyses of HCV NS3 Protease Val36 Variants
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V55 E56 G57 E58 V59 Q60 I61 M62 S63 R88 T89 I90 A91 W111 G116
Binding residue
(residue number reindexed from 1)		V1 E2 G3 E4 V5 Q6 I7 M8 S9 R34 T35 I36 A37 W57 G62
Enzymatic activity
Catalytic site (original residue number in PDB) H83 D107 G163 S165
Catalytic site (residue number reindexed from 1) H29 D53 G109 S111
Enzyme Commision number 3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2qv1, PDBe:2qv1, PDBj:2qv1
PDBsum2qv1
PubMed
UniProtA1Z093

[Back to BioLiP]