Structure of PDB 2qt5 Chain A Binding Site BS01

Receptor Information
>2qt5 Chain A (length=194) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLD
VGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSIQGSSV
MFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGT
IKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qt5 Supramodular nature of GRIP1 revealed by the structure of its PDZ12 tandem in complex with the carboxyl tail of Fras1.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
T63 L64 G65 L66 T67 V68 R84 H114 I118
Binding residue
(residue number reindexed from 1)
T17 L18 G19 L20 T21 V22 R38 H68 I72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2qt5, PDBe:2qt5, PDBj:2qt5
PDBsum2qt5
PubMed18155042
UniProtP97879|GRIP1_RAT Glutamate receptor-interacting protein 1 (Gene Name=Grip1)

[Back to BioLiP]