Structure of PDB 2qn6 Chain A Binding Site BS01

Receptor Information
>2qn6 Chain A (length=393) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTLGYAETNIGVCESCKKP
EAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAI
LVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQ
IKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVM
LVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQG
KVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSI
ITLADAEVPVLWNIRIKYNLLERVVVDPIRAKETLMLSVGSSTTLGIVTS
VKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Ligand information
>2qn6 Chain C (length=18) Species: 273057 (Saccharolobus solfataricus P2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSEKEYVEMLDRLYSKLP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qn6 Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		P65 E66 Q148 V151 V154 K156 A159 Y163 R164 P179 P182 V183 H187 I189 N190 D192 S193
Binding residue
(residue number reindexed from 1)		P50 E51 Q133 V136 V139 K141 A144 Y148 R149 P164 P167 V168 H172 I174 N175 D177 S178
Enzymatic activity
Catalytic site (original residue number in PDB) D19 K22 T23 H97
Catalytic site (residue number reindexed from 1) D18 K21 T22 H82
Enzyme Commision number 3.6.5.3: protein-synthesizing GTPase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003743 translation initiation factor activity
GO:0003746 translation elongation factor activity
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0006412 translation
GO:0006413 translational initiation
GO:0006414 translational elongation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2qn6, PDBe:2qn6, PDBj:2qn6
PDBsum2qn6
PubMed18000047
UniProtQ980A5|IF2G_SACS2 Translation initiation factor 2 subunit gamma (Gene Name=eif2g)

[Back to BioLiP]