Structure of PDB 2qkk Chain A Binding Site BS01

Receptor Information
>2qkk Chain A (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTN
QRAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKT
SAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAK
QSED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qkk Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
Resolution3.2 Å
Binding residue
(original residue number in PDB)		C147 C148 S149 S150 N151 R153 N182 N210 M212 H260 P262 G263 R278
Binding residue
(residue number reindexed from 1)		C15 C16 S17 S18 N19 R21 N50 N78 M80 H128 P130 G131 R146
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qkk, PDBe:2qkk, PDBj:2qkk
PDBsum2qkk
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]