Structure of PDB 2qk9 Chain A Binding Site BS01

Receptor Information
>2qk9 Chain A (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQ
RAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTS
AGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQ
SED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qk9 Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
Resolution2.55 Å
Binding residue
(original residue number in PDB)		C147 C148 S150 N151 R153 N182 E186 N210 M212 A234 K236 H260 P262 R278
Binding residue
(residue number reindexed from 1)		C14 C15 S17 N18 R20 N49 E53 N77 M79 A101 K103 H127 P129 R145
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qk9, PDBe:2qk9, PDBj:2qk9
PDBsum2qk9
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]