Structure of PDB 2qiy Chain A Binding Site BS01

Receptor Information
>2qiy Chain A (length=134) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTVQDICFAFLQNYYERMRTDPSKLAYFYASTAELTHTNYQSKKDDVLPT
VKVTGRENINKFFSRNDAKVRSLKLKLDTIDFQYTGHLHKSILIMATGEM
FWTGTPVYKFCQTFILLPSSTFDITNDIIRFISN
Ligand information
>2qiy Chain C (length=25) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LPLFINTTEAEFAAASVQRYELNMK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qiy Molecular basis for bre5 cofactor recognition by the ubp3 deubiquitylating enzyme.
Resolution1.69 Å
Binding residue
(original residue number in PDB)		F10 Y17 E18 R21 K50 D51 D52 L79 K80 L81 K82 L83 D84 E105 F107 T111 P112 V113 Y114
Binding residue
(residue number reindexed from 1)		F8 Y15 E16 R19 K44 D45 D46 L73 K74 L75 K76 L77 D78 E99 F101 T105 P106 V107 Y108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2qiy, PDBe:2qiy, PDBj:2qiy
PDBsum2qiy
PubMed17632125
UniProtP53741|BRE5_YEAST UBP3-associated protein BRE5 (Gene Name=BRE5)

[Back to BioLiP]