Structure of PDB 2qic Chain A Binding Site BS01

Receptor Information
>2qic Chain A (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRG
E
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qic Histone H3K4me3 binding is required for the DNA repair and apoptotic activities of ING1 tumor suppressor.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y212 S219 Y220 G221 E222 M223 I224 G225 E234 W235 F238 K246 P247 G249
Binding residue
(residue number reindexed from 1)		Y4 S11 Y12 G13 E14 M15 I16 G17 E26 W27 F30 K38 P39 G41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2qic, PDBe:2qic, PDBj:2qic
PDBsum2qic
PubMed18533182
UniProtQ9UK53|ING1_HUMAN Inhibitor of growth protein 1 (Gene Name=ING1)

[Back to BioLiP]