Structure of PDB 2qhb Chain A Binding Site BS01

Receptor Information
>2qhb Chain A (length=86) Species: 35889 (Nicotiana glutinosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKW
KTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qhb Complex structure of plant telomere bindig protein, NgTRF and telomere DNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R601 Y616 K620 K624
Binding residue
(residue number reindexed from 1)		R28 Y43 K47 K51
Enzymatic activity
Enzyme Commision number ?
External links