Structure of PDB 2qfj Chain A Binding Site BS01

Receptor Information

>2qfj Chain A (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SAAQRQGALAIMSRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDVTK
HKGFAFVEYEVPEAAQLALEQMNSVMLGRNIKVGRPSNIGQAQPIIDQLA
EEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSATLARDPTTGKHKGY
GFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTP

Ligand information

>2qfj Chain C (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2qfj Dimerization of FIR upon FUSE DNA binding suggests a mechanism of c-myc inhibition
Resolution	2.1 Å
Binding residue (original residue number in PDB)	Y115 F155 P188 S189
Binding residue (residue number reindexed from 1)	Y16 F54 P86 S87

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:2qfj, PDBe:2qfj, PDBj:2qfj
PDBsum	2qfj
PubMed	18059478
UniProt	Q9UHX1\|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 (Gene Name=PUF60)

[Back to BioLiP]