Structure of PDB 2qfc Chain A Binding Site BS01

Receptor Information

>2qfc Chain A (length=284) Species: 339854 (Bacillus thuringiensis serovar israelensis ATCC 35646) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGI
AAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNEL
KKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVY
QNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNH
AKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYE
EAEIEDAYKKASFFFDILEMHAYKEALVNKISRL

Ligand information

>2qfc Chain C (length=5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LPFEF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2qfc Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria
Resolution	2.6 Å
Binding residue (original residue number in PDB)	N163 A166 K197 Y200 N201 K204 L234 Y275
Binding residue (residue number reindexed from 1)	N161 A164 K195 Y198 N199 K202 L232 Y273

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:2qfc, PDBe:2qfc, PDBj:2qfc
PDBsum	2qfc
PubMed	17998541
UniProt	Q45782

[Back to BioLiP]