Structure of PDB 2qas Chain A Binding Site BS01

Receptor Information
>2qas Chain A (length=120) Species: 155892 (Caulobacter vibrioides) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPEDLMQYEAMAQDALRGVVKAALKKAAAPGGLPEPHHLYITFKTKAAGV
SGPQDLLSKYPDEMTIVLQHQYWDLAPGETFFSVTLKFGGQPKRLSVPYA
ALTRFYDPSVQFALQFSAPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qas Crystal structure of Caulobacter crescentus SspB ortholog
Resolution2.55 Å
Binding residue
(original residue number in PDB)		Y45 Y65 T70 I71 V72 Q74 H75 Q76 L91 K92 F93 G94 G95
Binding residue
(residue number reindexed from 1)		Y40 Y60 T65 I66 V67 Q69 H70 Q71 L86 K87 F88 G89 G90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding

View graph for
Molecular Function
External links
PDB RCSB:2qas, PDBe:2qas, PDBj:2qas
PDBsum2qas
PubMed
UniProtQ9A6J2

[Back to BioLiP]