Structure of PDB 2q3y Chain A Binding Site BS01

Receptor Information
>2q3y Chain A (length=244) Species: 32644 (unidentified) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLISILEAIEPEVVYAGYDNSQPDTTNYLLSSLNRLAGKQMVSVVKWAKA
LPGFRNLHLDDQMTLIQYSWMSLMAFSLGWRSYKHTNGQMLYFAPDLIFN
EERMQQSAMYDLCQGMRQISQEFVRLQVTYEEFLCMKVLLLLSTVPKDGL
KSQASFDEMRMNYIKELRRAIENNSSQNWQRFYQLTKLLDSMHDLVGGLL
QFCFYTFVQSQALSVEFPEMLVEIISDQLPKVMAGMAKPLLFHK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2q3y Crystal structure of an ancient protein: evolution by conformational epistasis
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V44 K48 L58 Q61 M62 E221 M222 E225 I226 D229
Binding residue
(residue number reindexed from 1)		V45 K49 L59 Q62 M63 E219 M220 E223 I224 D227
External links