Structure of PDB 2q3i Chain A Binding Site BS01

Receptor Information
>2q3i Chain A (length=45) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2q3i Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
Resolution1.5 Å
Binding residue
(original residue number in PDB)
L32 W35 L40
Binding residue
(residue number reindexed from 1)
L32 W35 L40
Enzymatic activity
Enzyme Commision number ?
External links