Structure of PDB 2q2t Chain A Binding Site BS01

Receptor Information

>2q2t Chain A (length=293) Species: 10506 (Paramecium bursaria Chlorella virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNS
VMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDY
VTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQ
YERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISM
TALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTG
FDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR

Ligand information

>2q2t Chain B (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttccgatagtggggtcgcaat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2q2t Structural basis for nick recognition by a minimal pluripotent DNA ligase.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	S80 M83 T84 G85 K173 T178 K180 L203 F204 K205 N206 Y217 S218 R220 G234 S235 F245 S246 G248 K281 C283 F286
Binding residue (residue number reindexed from 1)	S80 M83 T84 G85 K173 T178 K180 L203 F204 K205 N206 Y217 S218 R220 G234 S235 F245 S246 G248 K281 C283 F286

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0003909	DNA ligase activity
GO:0003910	DNA ligase (ATP) activity
GO:0005524	ATP binding
GO:0016874	ligase activity

	Biological Process
GO:0006260	DNA replication
GO:0006281	DNA repair
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2q2t, PDBe:2q2t, PDBj:2q2t
PDBsum	2q2t
PubMed	17618295
UniProt	O41026

[Back to BioLiP]