Structure of PDB 2q0n Chain A Binding Site BS01

Receptor Information
>2q0n Chain A (length=294) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLV
AVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEF
LEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSIL
LTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVD
IWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKG
FLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2q0n Structure of human p21 activating kinase 4 (PAK4) in complex with a consensus peptide.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		G330 S331 R359 T404 D440 K442 D444 F461 S474 L475 V476 G477 T478 Y480 W481 F516 N517 E518 P520
Binding residue
(residue number reindexed from 1)		G33 S34 R62 T107 D143 K145 D147 F164 S177 L178 V179 G180 T181 Y183 W184 F219 N220 E221 P223
Enzymatic activity
Catalytic site (original residue number in PDB) D440 K442 D444 S445 D458 K467 T478
Catalytic site (residue number reindexed from 1) D143 K145 D147 S148 D161 K170 T181
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2q0n, PDBe:2q0n, PDBj:2q0n
PDBsum2q0n
PubMed
UniProtO96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 (Gene Name=PAK4)

[Back to BioLiP]