Structure of PDB 2pxp Chain A Binding Site BS01

Receptor Information
>2pxp Chain A (length=69) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQ
DVNRLLKQFDDMQRMMKKM
Ligand information
>2pxp Chain B (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggcuguuuaccaggucagguccgaaaggaagcagccaaggcagcucc
<<<<<<<<<<....<<<....<<<....>>>....>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pxp A General Strategy to Solve the Phase Problem in RNA Crystallography.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		A30 N33 S34 M35 K38 S49 R50 R53 G57 S58 G59 M60
Binding residue
(residue number reindexed from 1)		A17 N20 S21 M22 K25 S36 R37 R40 G44 S45 G46 M47
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pxp, PDBe:2pxp, PDBj:2pxp
PDBsum2pxp
PubMed17637337
UniProtP0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)

[Back to BioLiP]