Structure of PDB 2pv2 Chain A Binding Site BS01

Receptor Information
>2pv2 Chain A (length=103) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSA
DQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVN
DLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pv2 The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
Resolution1.3 Å
Binding residue
(original residue number in PDB)		H178 E185 M231 W233 G234 R235 E238 L239 F243 S261 H266 L268
Binding residue
(residue number reindexed from 1)		H7 E14 M60 W62 G63 R64 E67 L68 F72 S90 H95 L97
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity

View graph for
Molecular Function
External links
PDB RCSB:2pv2, PDBe:2pv2, PDBj:2pv2
PDBsum2pv2
PubMed17825319
UniProtP0ABZ6|SURA_ECOLI Chaperone SurA (Gene Name=surA)

[Back to BioLiP]