Structure of PDB 2pv1 Chain A Binding Site BS01

Receptor Information
>2pv1 Chain A (length=103) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSA
DQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVN
DLR
Ligand information
>2pv1 Chain B (length=7) Species: 264732 (Moorella thermoacetica ATCC 39073) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WEYIPNV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pv1 The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
Resolution1.3 Å
Binding residue
(original residue number in PDB)		L174 L176 H178 D222 Q224 M231 G232 W233 G234 R235 L239 F243 S261 H266
Binding residue
(residue number reindexed from 1)		L3 L5 H7 D51 Q53 M60 G61 W62 G63 R64 L68 F72 S90 H95
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity

View graph for
Molecular Function
External links
PDB RCSB:2pv1, PDBe:2pv1, PDBj:2pv1
PDBsum2pv1
PubMed17825319
UniProtP0ABZ6|SURA_ECOLI Chaperone SurA (Gene Name=surA)

[Back to BioLiP]