Structure of PDB 2pua Chain A Binding Site BS01

Receptor Information

>2pua Chain A (length=339) Species: 562 (Escherichia coli)

ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVA
RSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNL
EKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAK
ADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFM
KAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMA
MGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETA
FNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR

Ligand information

>2pua Chain B (length=17)

tacgcaaacgtttgcgt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2pua Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): S14 T16 T17 R26 V28 A29 T32 L54 K55
• Binding residue (residue number reindexed from 1): S13 T15 T16 R25 V27 A28 T31 L53 K54

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0002057 guanine binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900372 negative regulation of purine nucleotide biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2pua, PDBe:2pua, PDBj:2pua
• PDBsum: 2pua
• PubMed: 7973627
• UniProt: P0ACP7|PURR_ECOLI HTH-type transcriptional repressor PurR (Gene Name=purR)