Structure of PDB 2psx Chain A Binding Site BS01

Receptor Information

>2psx Chain A (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRV
RLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPT
KDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKR
CEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPC
ARPNRPGVYTNLCKFTKWIQETIQANS

Ligand information

>2psx Chain B (length=3) Species: 66430 (Streptomyces roseus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LLR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2psx Structural basis of the zinc inhibition of human tissue kallikrein 5.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	H57 H99 D189 S190 C191 Q192 S195 W215 G216 Y218
Binding residue (residue number reindexed from 1)	H42 H84 D173 S174 C175 Q176 S179 W195 G196 Y198

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1)	H42 D87 Q176 G177 D178 S179 G180
Enzyme Commision number	3.4.21.-

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2psx, PDBe:2psx, PDBj:2psx
PDBsum	2psx
PubMed	17881000
UniProt	Q9Y337\|KLK5_HUMAN Kallikrein-5 (Gene Name=KLK5)

[Back to BioLiP]