Structure of PDB 2pqk Chain A Binding Site BS01

Receptor Information
>2pqk Chain A (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DELYRQSLEIISRYLREQATGAKDTKGATSRKALETLRRVGDGVQRNHET
AFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAK
HLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pqk Mcl-1-Bim complexes accommodate surprising point mutations via minor structural changes.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		V216 H224 G230 M231 K234 L235 R248 V249 V253 D256 N260 G262 R263 V265 F318 F319
Binding residue
(residue number reindexed from 1)		V40 H48 G54 M55 K58 L59 R72 V73 V77 D80 N84 G86 R87 V89 F142 F143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2pqk, PDBe:2pqk, PDBj:2pqk
PDBsum2pqk
PubMed20066663
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]