Structure of PDB 2po1 Chain A Binding Site BS01

Receptor Information
>2po1 Chain A (length=236) Species: 29292 (Pyrococcus abyssi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYG
PRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGA
LEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDL
VAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLT
KDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2po1 Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
Resolution1.94 Å
Binding residue
(original residue number in PDB)		H66 V86 R96 R97 A132 D133 A134 D180
Binding residue
(residue number reindexed from 1)		H58 V78 R88 R89 A124 D125 A126 D172
Enzymatic activity
Enzyme Commision number 3.1.13.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0004527 exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
Biological Process
GO:0006401 RNA catabolic process
GO:0016075 rRNA catabolic process
Cellular Component
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2po1, PDBe:2po1, PDBj:2po1
PDBsum2po1
PubMed18353775
UniProtQ9V119|RRP41_PYRAB Exosome complex component Rrp41 (Gene Name=rrp41)

[Back to BioLiP]