Structure of PDB 2ply Chain A Binding Site BS01

Receptor Information
>2ply Chain A (length=212) Species: 1525 (Moorella thermoacetica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGLDVTLLRVDLYAISTERYQAWWQAVTRALEEFHSRYPLRPGLAREELR
SRYFSRLPARVYQALLEEWSREGRLQLAANTVALAGFTPSFSETQKKLLK
DLEDKYRVSRWQPPWVKEVAGSFNLDPSELEELLHYLVREGVLVKINDEF
YWHRQALGEAREVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVK
FTRRVGDKRVVV
Ligand information
>2ply Chain C (length=23) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcguugccggucuggcaacgcc
<<<<<<<<<.....>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ply Structural insight into a molecular switch in tandem winged-helix motifs from elongation factor SelB.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R457 Y458 R461 N500 S548 E551 E552 H555 V558 R559 Q618
Binding residue
(residue number reindexed from 1)		R37 Y38 R41 N80 S128 E131 E132 H135 V138 R139 Q198
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003746 translation elongation factor activity
GO:0005525 GTP binding
Biological Process
GO:0001514 selenocysteine incorporation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ply, PDBe:2ply, PDBj:2ply
PDBsum2ply
PubMed17537456
UniProtQ46455|SELB_MOOTH Selenocysteine-specific elongation factor (Gene Name=selB)

[Back to BioLiP]