Structure of PDB 2pku Chain A Binding Site BS01

Receptor Information
>2pku Chain A (length=87) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAG
DEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pku Clustering and synaptic targeting of PICK1 requires direct interaction between the PDZ domain and lipid membranes
ResolutionN/A
Binding residue
(original residue number in PDB)		L32 I33 G34 I35 I37 F53 K83 A87 I90 Q91
Binding residue
(residue number reindexed from 1)		L15 I16 G17 I18 I20 F36 K66 A70 I73 Q74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2pku, PDBe:2pku, PDBj:2pku
PDBsum2pku
PubMed17914463
UniProtQ9EP80|PICK1_RAT PRKCA-binding protein (Gene Name=Pick1)

[Back to BioLiP]