Structure of PDB 2pjp Chain A Binding Site BS01

Receptor Information
>2pjp Chain A (length=121) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FSEEQQAIWQKAEPLFGDEPWWVRDLAKETGTDEQAMRLTLRQAAQQGII
TAIVKDRYYRNDRIVEFANMIRDLDQECGSTCAADFRDRLGVGRKLAIQI
LEYFDRIGFTRRRGNDHLLRD
Ligand information
>2pjp Chain B (length=23) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcgguugcaggucugcaccgcc
<<<<<.<<<<<..>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pjp Structural insight into a molecular switch in tandem winged-helix motifs from elongation factor SelB.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		W508 R510 D542 R573 G579 R580 K581 I584 E588 R598 N601 H603
Binding residue
(residue number reindexed from 1)		W22 R24 D56 R87 G93 R94 K95 I98 E102 R112 N115 H117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003746 translation elongation factor activity
GO:0005525 GTP binding
Biological Process
GO:0001514 selenocysteine incorporation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pjp, PDBe:2pjp, PDBj:2pjp
PDBsum2pjp
PubMed17537456
UniProtP14081|SELB_ECOLI Selenocysteine-specific elongation factor (Gene Name=selB)

[Back to BioLiP]