Structure of PDB 2pie Chain A Binding Site BS01

Receptor Information
>2pie Chain A (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAHMAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLM
ISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQL
GVPLENKENAEYEYEVTEEDWETIYPCLSPKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pie RNF8 Transduces the DNA-Damage Signal via Histone Ubiquitylation and Checkpoint Protein Assembly.
Resolution1.35 Å
Binding residue
(original residue number in PDB)
R42 C55 L57 M58 S60 R61 L82 N83
Binding residue
(residue number reindexed from 1)
R34 C47 L49 M50 S52 R53 L74 N75
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:2pie, PDBe:2pie, PDBj:2pie
PDBsum2pie
PubMed18001825
UniProtO76064|RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 (Gene Name=RNF8)

[Back to BioLiP]