Structure of PDB 2pfj Chain A Binding Site BS01

Receptor Information
>2pfj Chain A (length=129) Species: 10760 (Escherichia phage T7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFLLPNGIFVET
AGLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKH
GIKFADKLIPAEWIKEPKKEVPFDRLKRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pfj The structural basis of Holliday junction resolution by T7 endonuclease I.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
G18 Y102
Binding residue
(residue number reindexed from 1)
G2 Y86
Enzymatic activity
Enzyme Commision number 3.1.21.2: deoxyribonuclease IV.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0008821 crossover junction DNA endonuclease activity
GO:0008833 deoxyribonuclease IV (phage-T4-induced) activity
GO:1990238 double-stranded DNA endonuclease activity
Biological Process
GO:0015074 DNA integration
GO:0016032 viral process
GO:0039657 symbiont-mediated suppression of host gene expression
GO:0099015 degradation of host chromosome by virus

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2pfj, PDBe:2pfj, PDBj:2pfj
PDBsum2pfj
PubMed17873858
UniProtP00641|ENDO_BPT7 Endonuclease I (Gene Name=3)

[Back to BioLiP]