Structure of PDB 2pdz Chain A Binding Site BS01

Receptor Information
>2pdz Chain A (length=86) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDA
ILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pdz Specific interactions between the syntrophin PDZ domain and voltage-gated sodium channels.
ResolutionN/A
Binding residue
(original residue number in PDB)		L14 G15 I16 S17 I18 G20 F34 H64 D65 V68 L71
Binding residue
(residue number reindexed from 1)		L14 G15 I16 S17 I18 G20 F34 H64 D65 V68 L71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity

View graph for
Molecular Function
External links
PDB RCSB:2pdz, PDBe:2pdz, PDBj:2pdz
PDBsum2pdz
PubMed9437424
UniProtQ61234|SNTA1_MOUSE Alpha-1-syntrophin (Gene Name=Snta1)

[Back to BioLiP]