Structure of PDB 2pbk Chain A Binding Site BS01

Receptor Information
>2pbk Chain A (length=228) Species: 37296 (Human gammaherpesvirus 8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QGLYVGGFVDVVSCPKLEQELYLDPDQVTDYLPVTEPLPITIEHLPETEV
GWTLGLFQVSHGIFCTGAITSPAFLELASRLADTSHVARAPVKNLPKEPL
LEILHTWLPGLSLSSIHPRELSQTPSGPVFQHVSLCALGRRRGTVAVYGH
DAEWVVSRFSSVSKSERAHILQHVSSCRLEDLSTPNFVSPLETLMAKAID
AGFIRDRLDLLKTDRGVASILSPVYLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pbk Substrate modulation of enzyme activity in the herpesvirus protease family.
Resolution1.73 Å
Binding residue
(original residue number in PDB)		H46 S114 L115 S116 S117 I118 H119 P130 G141 R142
Binding residue
(residue number reindexed from 1)		H44 S112 L113 S114 S115 I116 H117 P128 G139 R140
Enzymatic activity
Catalytic site (original residue number in PDB) H46 S114 S116 H134 R142 R143
Catalytic site (residue number reindexed from 1) H44 S112 S114 H132 R140 R141
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2pbk, PDBe:2pbk, PDBj:2pbk
PDBsum2pbk
PubMed17870089
UniProtQ2HRB6|SCAF_HHV8P Capsid scaffolding protein (Gene Name=ORF17)

[Back to BioLiP]