Structure of PDB 2p4r Chain A Binding Site BS01

Receptor Information
>2p4r Chain A (length=55) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSN
YVREI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2p4r A novel interaction between atrophin-interacting protein 4 and beta-p21-activated kinase-interactive exchange factor is mediated by an SH3 domain.
Resolution2.001 Å
Binding residue
(original residue number in PDB)		F15 T20 D23 E24 T36 G41 W43 E45 W54 P56 N58 Y59
Binding residue
(residue number reindexed from 1)		F7 T12 D15 E16 T28 G33 W35 E37 W46 P48 N50 Y51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2p4r, PDBe:2p4r, PDBj:2p4r
PDBsum2p4r
PubMed17652093
UniProtO55043|ARHG7_RAT Rho guanine nucleotide exchange factor 7 (Gene Name=Arhgef7)

[Back to BioLiP]