Structure of PDB 2p1v Chain A Binding Site BS01

Receptor Information

>2p1v Chain A (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DMPVERILEAELAVEDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQ
VILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFD
RVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVY
ASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPI
DTFLMEMLEAP

Ligand information

>2p1v Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2p1v Modulators of the structural dynamics of the retinoid X receptor to reveal receptor function.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	V280 K284 V298 R302 F450 E453 E456
Binding residue (residue number reindexed from 1)	V33 K37 V51 R55 F203 E206 E209

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2p1v, PDBe:2p1v, PDBj:2p1v
PDBsum	2p1v
PubMed	17947383
UniProt	P19793\|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]