Structure of PDB 2p0j Chain A Binding Site BS01

Receptor Information

>2p0j Chain A (length=203) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRIVEVYSHLNGLEYIQVHLPHIWEEIQEIIVSIDAEACRTKESKEKTKQ
GQILYSPVALNEAFKEKLEAKGWKESRTNYYVTADPKLIRETLSLEPEEQ
KKVIEAAGKEALKSYNQTDFVKDRVAIEVQFGKYSFVAYDLFVKHMAFYV
SDKIDVGVEILPMKELSKEMSSGISYYEGELYNVIRQGRGVPAVPLVLIG
IAP

Ligand information

>2p0j Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgaatccata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2p0j BstYI Bound to Noncognate DNA Reveals a "Hemispecific" Complex: Implications for DNA Scanning.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	K42 K45 E46 P57 K133 S171 S172
Binding residue (residue number reindexed from 1)	K42 K45 E46 P57 K133 S171 S172

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003677	DNA binding
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0042802	identical protein binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2p0j, PDBe:2p0j, PDBj:2p0j
PDBsum	2p0j
PubMed	17437717
UniProt	Q84AF2

[Back to BioLiP]