Structure of PDB 2oxv Chain A Binding Site BS01

Receptor Information
>2oxv Chain A (length=261) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEI
NEALKKIDPDLGGTLFVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQG
KDIINIRNGLLVGKRGDQDLMTAGNAIERSHKNISEIANFMLSESHFPYV
LFLEGSNFLTENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSN
LCINKFVNHKDKSIMLQAASIYTQGDGREWDSKIMFEIMFDISTTSLRVL
GRDLFEQLTSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2oxv Structural and thermodynamic basis for enhanced DNA binding by a promiscuous mutant EcoRI endonuclease.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		S86 S87 I88 K89 K113 H114 Q115 K117 G129 K130 M137 T138 G140 N141 A142 R145
Binding residue
(residue number reindexed from 1)		S70 S71 I72 K73 K97 H98 Q99 K101 G113 K114 M121 T122 G124 N125 A126 R129
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2oxv, PDBe:2oxv, PDBj:2oxv
PDBsum2oxv
PubMed17997963
UniProtP00642|T2E1_ECOLX Type II restriction enzyme EcoRI (Gene Name=ecoRIR)

[Back to BioLiP]