Structure of PDB 2oxm Chain A Binding Site BS01

Receptor Information
>2oxm Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM
CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDI
EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVS
WLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGC
RHFSKTNELLQKSGKKPIDWKEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2oxm Enzymatic capture of an extrahelical thymine in the search for uracil in DNA.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q144 H148 H212 A214 G246 S247 H268 S270 P271 L272 S273 R276
Binding residue
(residue number reindexed from 1)		Q63 H67 H131 A133 G165 S166 H187 S189 P190 L191 S192 R195
Enzymatic activity
Enzyme Commision number 3.2.2.27: uracil-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0004844 uracil DNA N-glycosylase activity
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2oxm, PDBe:2oxm, PDBj:2oxm
PDBsum2oxm
PubMed17704764
UniProtP13051|UNG_HUMAN Uracil-DNA glycosylase (Gene Name=UNG)

[Back to BioLiP]