Structure of PDB 2otu Chain A Binding Site BS01

Receptor Information
>2otu Chain A (length=115) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVME
LKKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIK
EQFVYVFGGGTKVTV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2otu Implications of the structure of a poly-Gln/anti-poly-Gln complex for disease progression and therapy
Resolution1.68 Å
Binding residue
(original residue number in PDB)		S26 Q27 H28 S29 Y31 T32 G95 D96 T97 F102
Binding residue
(residue number reindexed from 1)		S27 Q28 H29 S30 Y32 T33 G96 D97 T98 F103
External links