Structure of PDB 2ost Chain A Binding Site BS01

Receptor Information
>2ost Chain A (length=148) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSTKLKGDIAQQAAIMRALKMGWGVLKPLGDRLSYDLVFDVEGILLKVQ
VKSSWKSEKTGNYVVDNRRTRTNRRNIVRSPYRGNDFDFAVAYVEELELF
YVFPVDVFISYGSEIHLVETDKRQRKPRSFGYREAWHLILQKGAAQKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ost The restriction fold turns to the dark side: a bacterial homing endonuclease with a PD-(D/E)-XK motif.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T3 K6 G7 D31 D36 S52 W54 T69 R70 N72 R73 R74 E113 Q123 R124
Binding residue
(residue number reindexed from 1)		T4 K7 G8 D32 D37 S53 W55 T70 R71 N73 R74 R75 E114 Q124 R125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:2ost, PDBe:2ost, PDBj:2ost
PDBsum2ost
PubMed17410205
UniProtQ57253

[Back to BioLiP]