Structure of PDB 2os6 Chain A Binding Site BS01

Receptor Information
>2os6 Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGD
RIIKVNGTLVTHSNHLEVVKLIKSGSYVALTVQGRPPGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2os6 Solution structure of the LARG PDZ domain in complex with C-terminal peptide of Plexin B1
ResolutionN/A
Binding residue
(original residue number in PDB)
F20 G21 L22 T23 V24 S25 G26 H65
Binding residue
(residue number reindexed from 1)
F20 G21 L22 T23 V24 S25 G26 H65
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2os6, PDBe:2os6, PDBj:2os6
PDBsum2os6
PubMed
UniProtQ9NZN5|ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 (Gene Name=ARHGEF12)

[Back to BioLiP]