Structure of PDB 2oqs Chain A Binding Site BS01

Receptor Information
>2oqs Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQI
GDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2oqs Solution structure of the hDlg/SAP97 PDZ2 domain and its mechanism of interaction with HPV-18 papillomavirus E6 protein.
ResolutionN/A
Binding residue
(original residue number in PDB)		L12 F14 S15 I16 A17 G21 N22 Q23 H24 T34 I37 H67 V71
Binding residue
(residue number reindexed from 1)		L12 F14 S15 I16 A17 G21 N22 Q23 H24 T34 I37 H67 V71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2oqs, PDBe:2oqs, PDBj:2oqs
PDBsum2oqs
PubMed17713926
UniProtQ12959|DLG1_HUMAN Disks large homolog 1 (Gene Name=DLG1)

[Back to BioLiP]